Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3qnya1: 3qny A:2-112 [215313] Other proteins in same PDB: d3qnya2, d3qnyc2 automated match to d1rhha1 complexed with gol |
PDB Entry: 3qny (more details), 2.3 Å
SCOPe Domain Sequences for d3qnya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qnya1 b.1.1.0 (A:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstras gvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleik
Timeline for d3qnya1: