Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fc (human) IgE [49121] (3 PDB entries) |
Domain d1fp5a2: 1fp5 A:439-543 [21531] |
PDB Entry: 1fp5 (more details), 2.3 Å
SCOP Domain Sequences for d1fp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE} praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv
Timeline for d1fp5a2: