SCOP 1.63: Domain d1fp5a2: 1fp5 A:439-543

Lineage for d1fp5a2 (1fp5 A:439-543)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fc (human) IgE [49121] (3 PDB entries)

8. Domain d1fp5a2: 1fp5 A:439-543 [21531]

Details for d1fp5a2

PDB Entry: 1fp5, 2.3 Å

PDB Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.

SCOP Domain Sequences for d1fp5a2:

Sequence; same for both SEQRES and ATOM records:

>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

Timeline for d1fp5a2:

• d1fp5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1fp5a2 appears in SCOP 1.61
  
• d1fp5a2 appears in SCOP 1.65
  
• d1fp5a2 appears in the current release, SCOPe 2.08