Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [226082] (1 PDB entry) |
Domain d3qn3c1: 3qn3 C:0-136 [215304] Other proteins in same PDB: d3qn3a2, d3qn3b2, d3qn3c2, d3qn3d2 automated match to d1w6ta2 complexed with gol, mg, mpd, so4 |
PDB Entry: 3qn3 (more details), 2.13 Å
SCOPe Domain Sequences for d3qn3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qn3c1 d.54.1.0 (C:0-136) automated matches {Campylobacter jejuni [TaxId: 197]} amlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfg gkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatar aaaaalgmplyrylgga
Timeline for d3qn3c1: