Lineage for d3qn3c1 (3qn3 C:0-136)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413071Species Campylobacter jejuni [TaxId:197] [226082] (1 PDB entry)
  8. 1413074Domain d3qn3c1: 3qn3 C:0-136 [215304]
    Other proteins in same PDB: d3qn3a2, d3qn3b2, d3qn3c2, d3qn3d2
    automated match to d1w6ta2
    complexed with gol, mg, mpd, so4

Details for d3qn3c1

PDB Entry: 3qn3 (more details), 2.13 Å

PDB Description: phosphopyruvate hydratase from campylobacter jejuni.
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d3qn3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qn3c1 d.54.1.0 (C:0-136) automated matches {Campylobacter jejuni [TaxId: 197]}
amlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfg
gkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatar
aaaaalgmplyrylgga

SCOPe Domain Coordinates for d3qn3c1:

Click to download the PDB-style file with coordinates for d3qn3c1.
(The format of our PDB-style files is described here.)

Timeline for d3qn3c1: