Lineage for d1e4kb2 (1e4k B:342-444)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655864Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries)
  8. 655907Domain d1e4kb2: 1e4k B:342-444 [21529]
    Other proteins in same PDB: d1e4ka1, d1e4kb1, d1e4kc1, d1e4kc2
    part of a Fc
    complexed with fuc, gal, man, nag

Details for d1e4kb2

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex
PDB Compounds: (B:) fc fragment of human igg1

SCOP Domain Sequences for d1e4kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4kb2 b.1.1.2 (B:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1e4kb2:

Click to download the PDB-style file with coordinates for d1e4kb2.
(The format of our PDB-style files is described here.)

Timeline for d1e4kb2: