Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries) |
Domain d3qlha2: 3qlh A:430-554 [215287] Other proteins in same PDB: d3qlha1, d3qlha3, d3qlhb_ automated match to d1hqea1 complexed with dms, edo, mn, mnk, t27 |
PDB Entry: 3qlh (more details), 2.7 Å
SCOPe Domain Sequences for d3qlha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qlha2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsa
Timeline for d3qlha2: