Lineage for d1e4kb1 (1e4k B:229-341)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9145Species Fc (human) IgG1 class [49120] (6 PDB entries)
  8. 9160Domain d1e4kb1: 1e4k B:229-341 [21528]
    Other proteins in same PDB: d1e4kc1, d1e4kc2

Details for d1e4kb1

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex

SCOP Domain Sequences for d1e4kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4kb1 b.1.1.2 (B:229-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1e4kb1:

Click to download the PDB-style file with coordinates for d1e4kb1.
(The format of our PDB-style files is described here.)

Timeline for d1e4kb1: