Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
Domain d3qjhd2: 3qjh D:120-246 [215276] Other proteins in same PDB: d3qjha1, d3qjhb1, d3qjhc1, d3qjhd1 automated match to d1qsee2 |
PDB Entry: 3qjh (more details), 1.9 Å
SCOPe Domain Sequences for d3qjhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjhd2 b.1.1.2 (D:120-246) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
Timeline for d3qjhd2: