Lineage for d3qjhd1 (3qjh D:2-119)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2369907Domain d3qjhd1: 3qjh D:2-119 [215275]
    Other proteins in same PDB: d3qjha2, d3qjhb2, d3qjhc2, d3qjhd2
    automated match to d1qrne1

Details for d3qjhd1

PDB Entry: 3qjh (more details), 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR
PDB Compounds: (D:) 5c.c7 beta chain

SCOPe Domain Sequences for d3qjhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjhd1 b.1.1.0 (D:2-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllvied

SCOPe Domain Coordinates for d3qjhd1:

Click to download the PDB-style file with coordinates for d3qjhd1.
(The format of our PDB-style files is described here.)

Timeline for d3qjhd1: