SCOPe 2.05: Domain d3qjhd1: 3qjh D:2-119

Lineage for d3qjhd1 (3qjh D:2-119)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3qjhd1: 3qjh D:2-119 [215275]
   Other proteins in same PDB: d3qjha2, d3qjhb2, d3qjhc2, d3qjhd2
   automated match to d1qrne1

Details for d3qjhd1

PDB Entry: 3qjh, 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR

PDB Compounds: (D:) 5c.c7 beta chain

SCOPe Domain Sequences for d3qjhd1:

Sequence; same for both SEQRES and ATOM records:

>d3qjhd1 b.1.1.0 (D:2-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllvied

Timeline for d3qjhd1:

• d3qjhd1 first appeared in SCOPe 2.03
  
• d3qjhd1 appears in SCOPe 2.04
  
• d3qjhd1 appears in SCOPe 2.06
  
• d3qjhd1 appears in the current release, SCOPe 2.08