SCOPe 2.05: Domain d3qjhc2: 3qjh C:118-206

Lineage for d3qjhc2 (3qjh C:118-206)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3qjhc2: 3qjh C:118-206 [215274]
   Other proteins in same PDB: d3qjha1, d3qjhb1, d3qjhc1, d3qjhd1
   automated match to d1qrnd2

Details for d3qjhc2

PDB Entry: 3qjh, 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR

PDB Compounds: (C:) 5c.c7 alpha chain

SCOPe Domain Sequences for d3qjhc2:

Sequence, based on SEQRES records:

>d3qjhc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3qjhc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffps

Timeline for d3qjhc2:

• d3qjhc2 first appeared in SCOPe 2.03
  
• d3qjhc2 appears in SCOPe 2.04
  
• d3qjhc2 appears in SCOPe 2.06
  
• d3qjhc2 appears in the current release, SCOPe 2.08