Lineage for d1e4ka2 (1e4k A:342-444)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453852Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 453855Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)
  8. 453887Domain d1e4ka2: 1e4k A:342-444 [21527]
    Other proteins in same PDB: d1e4ka1, d1e4kb1, d1e4kc1, d1e4kc2

Details for d1e4ka2

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex

SCOP Domain Sequences for d1e4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ka2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1e4ka2:

Click to download the PDB-style file with coordinates for d1e4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1e4ka2: