SCOPe 2.04: Domain d3qjfb2: 3qjf B:116-243

Lineage for d3qjfb2 (3qjf B:116-243)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3qjfb2: 3qjf B:116-243 [215264]
   Other proteins in same PDB: d3qjfa2, d3qjfc2
   automated match to d1lp9f2

Details for d3qjfb2

PDB Entry: 3qjf, 2.4 Å

PDB Description: Crystal structure of the 2B4 TCR

PDB Compounds: (B:) 2B4 beta chain

SCOPe Domain Sequences for d3qjfb2:

Sequence; same for both SEQRES and ATOM records:

>d3qjfb2 b.1.1.0 (B:116-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d3qjfb2:

• d3qjfb2 first appeared in SCOPe 2.03
  
• d3qjfb2 appears in SCOPe 2.05
  
• d3qjfb2 appears in the current release, SCOPe 2.08