Lineage for d1e4ka1 (1e4k A:229-341)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2359879Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2359880Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2359994Domain d1e4ka1: 1e4k A:229-341 [21526]
    Other proteins in same PDB: d1e4ka2, d1e4kb2, d1e4kc1, d1e4kc2
    part of a Fc

Details for d1e4ka1

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex
PDB Compounds: (A:) fc fragment of human igg1

SCOPe Domain Sequences for d1e4ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ka1 b.1.1.2 (A:229-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1e4ka1:

Click to download the PDB-style file with coordinates for d1e4ka1.
(The format of our PDB-style files is described here.)

Timeline for d1e4ka1: