Lineage for d3qiud2 (3qiu D:117-243)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1295139Domain d3qiud2: 3qiu D:117-243 [215257]
    Other proteins in same PDB: d3qiua1, d3qiub1, d3qiuc1, d3qiud1
    automated match to d1qsee2
    complexed with nag

Details for d3qiud2

PDB Entry: 3qiu (more details), 2.7 Å

PDB Description: Crystal structure of the 226 TCR in complex with MCC/I-Ek
PDB Compounds: (D:) TCR 226 beta chain

SCOPe Domain Sequences for d3qiud2:

Sequence, based on SEQRES records: (download)

>d3qiud2 b.1.1.2 (D:117-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Sequence, based on observed residues (ATOM records): (download)

>d3qiud2 b.1.1.2 (D:117-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpadsryalssrlrvsatfwqnprnhfrcqvqfyglsdewtqdrakpvtqivsaeaw
gra

SCOPe Domain Coordinates for d3qiud2:

Click to download the PDB-style file with coordinates for d3qiud2.
(The format of our PDB-style files is described here.)

Timeline for d3qiud2: