Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries) |
Domain d3qiub1: 3qiu B:3-92 [215252] Other proteins in same PDB: d3qiua2, d3qiub2, d3qiuc1, d3qiuc2, d3qiud1, d3qiud2 automated match to d2sebb2 complexed with nag |
PDB Entry: 3qiu (more details), 2.7 Å
SCOPe Domain Sequences for d3qiub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qiub1 d.19.1.0 (B:3-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]} srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn sqpefleqkraevdtvcrhnyeifdnflvp
Timeline for d3qiub1: