Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3qibc1: 3qib C:2-111 [215244] Other proteins in same PDB: d3qiba1, d3qiba2, d3qibb1, d3qibb2, d3qibc2, d3qibd2 automated match to d1qrnd1 complexed with bma, fuc, nag, peg |
PDB Entry: 3qib (more details), 2.7 Å
SCOPe Domain Sequences for d3qibc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qibc1 b.1.1.0 (C:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]} qveqspsalslhegtgsalrcnftttmravqwfqqnsrgslinlfylasgtkengrlkst fnskesystlhirdaqledsgtyfcaalratggnnkltfgqgtvlsvipd
Timeline for d3qibc1: