![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225821] (6 PDB entries) |
![]() | Domain d3qibb1: 3qib B:3-93 [215242] Other proteins in same PDB: d3qiba1, d3qiba2, d3qibb2, d3qibc1, d3qibc2, d3qibd1, d3qibd2 automated match to d1kt2b2 complexed with bma, fuc, nag, peg |
PDB Entry: 3qib (more details), 2.7 Å
SCOPe Domain Sequences for d3qibb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qibb1 d.19.1.1 (B:3-93) automated matches {Mouse (Mus musculus) [TaxId: 10090]} srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn sqpefleqkraevdtvcrhnyeifdnflvpr
Timeline for d3qibb1: