Lineage for d3qibb1 (3qib B:3-93)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406849Protein automated matches [191280] (4 species)
    not a true protein
  7. 1406888Species Mouse (Mus musculus) [TaxId:10090] [225821] (1 PDB entry)
  8. 1406889Domain d3qibb1: 3qib B:3-93 [215242]
    Other proteins in same PDB: d3qiba1, d3qiba2, d3qibb2, d3qibc1, d3qibc2, d3qibd1, d3qibd2
    automated match to d1kt2b2
    complexed with bma, fuc, nag, peg

Details for d3qibb1

PDB Entry: 3qib (more details), 2.7 Å

PDB Description: Crystal structure of the 2B4 TCR in complex with MCC/I-Ek
PDB Compounds: (B:) MHC class II E-beta-k

SCOPe Domain Sequences for d3qibb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qibb1 d.19.1.1 (B:3-93) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn
sqpefleqkraevdtvcrhnyeifdnflvpr

SCOPe Domain Coordinates for d3qibb1:

Click to download the PDB-style file with coordinates for d3qibb1.
(The format of our PDB-style files is described here.)

Timeline for d3qibb1: