Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries) |
Domain d3qiba1: 3qib A:1-81 [215240] Other proteins in same PDB: d3qiba2, d3qibb1, d3qibb2, d3qibc1, d3qibc2, d3qibd1, d3qibd2 automated match to d2g9ha2 complexed with bma, fuc, nag, peg |
PDB Entry: 3qib (more details), 2.7 Å
SCOPe Domain Sequences for d3qiba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qiba1 d.19.1.0 (A:1-81) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal aniavdkanldvmkersnntp
Timeline for d3qiba1: