Lineage for d1fcca1 (1fcc A:238-341)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655805Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)
  8. 655846Domain d1fcca1: 1fcc A:238-341 [21524]
    Other proteins in same PDB: d1fcca2, d1fccb2, d1fccc_, d1fccd_
    part of a Fc

Details for d1fcca1

PDB Entry: 1fcc (more details), 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg
PDB Compounds: (A:) igg1 mo61 fc

SCOP Domain Sequences for d1fcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcca1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1fcca1:

Click to download the PDB-style file with coordinates for d1fcca1.
(The format of our PDB-style files is described here.)

Timeline for d1fcca1: