Lineage for d1fcca1 (1fcc A:238-341)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53986Species Fc (human) IgG1 class [49120] (8 PDB entries)
  8. 54011Domain d1fcca1: 1fcc A:238-341 [21524]
    Other proteins in same PDB: d1fccc_

Details for d1fcca1

PDB Entry: 1fcc (more details), 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

SCOP Domain Sequences for d1fcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcca1 b.1.1.2 (A:238-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1fcca1:

Click to download the PDB-style file with coordinates for d1fcca1.
(The format of our PDB-style files is described here.)

Timeline for d1fcca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcca2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fccc_