![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fc (human) IgG1 class [49120] (6 PDB entries) |
![]() | Domain d1fcca1: 1fcc A:238-341 [21524] Other proteins in same PDB: d1fccc_ |
PDB Entry: 1fcc (more details), 3.5 Å
SCOP Domain Sequences for d1fcca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcca1 b.1.1.2 (A:238-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class} psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg
Timeline for d1fcca1: