SCOPe 2.04: Domain d3qhzl1: 3qhz L:2-107

Lineage for d3qhzl1 (3qhz L:2-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3qhzl1: 3qhz L:2-107 [215236]
   Other proteins in same PDB: d3qhzl2, d3qhzm2
   automated match to d1lgva1

Details for d3qhzl1

PDB Entry: 3qhz, 1.55 Å

PDB Description: crystal structure of human anti-influenza fab 2d1

PDB Compounds: (L:) Human monoclonal antibody del2D1, Fab Light Chain

SCOPe Domain Sequences for d3qhzl1:

Sequence; same for both SEQRES and ATOM records:

>d3qhzl1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvpd
rfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlg

Timeline for d3qhzl1:

• d3qhzl1 first appeared in SCOPe 2.03
  
• d3qhzl1 appears in SCOPe 2.05
  
• d3qhzl1 appears in the current release, SCOPe 2.08