SCOPe 2.05: Domain d3qh3d2: 3qh3 D:117-245

Lineage for d3qh3d2 (3qh3 D:117-245)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d3qh3d2: 3qh3 D:117-245 [215233]
Other proteins in same PDB: d3qh3a1, d3qh3b1, d3qh3c1, d3qh3d1
automated match to d1ktke2
complexed with edo, gol

Details for d3qh3d2

PDB Entry: 3qh3 (more details), 2.19 Å

PDB Description: The crystal structure of TCR A6

PDB Compounds: (D:) A6 beta chain

SCOPe Domain Sequences for d3qh3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qh3d2 b.1.1.2 (D:117-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3qh3d2:

Click to download the PDB-style file with coordinates for d3qh3d2.
(The format of our PDB-style files is described here.)

Timeline for d3qh3d2: