SCOPe 2.08: Domain d3qh3a2: 3qh3 A:112-194

Lineage for d3qh3a2 (3qh3 A:112-194)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3qh3a2: 3qh3 A:112-194 [215227]
   Other proteins in same PDB: d3qh3a1, d3qh3b1, d3qh3c1, d3qh3d1
   automated match to d1qrnd2
   complexed with edo, gol

Details for d3qh3a2

PDB Entry: 3qh3, 2.19 Å

PDB Description: The crystal structure of TCR A6

PDB Compounds: (A:) A6 alpha chain

SCOPe Domain Sequences for d3qh3a2:

Sequence; same for both SEQRES and ATOM records:

>d3qh3a2 b.1.1.2 (A:112-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipe

Timeline for d3qh3a2:

• d3qh3a2 first appeared in SCOPe 2.03
  
• d3qh3a2 appears in SCOPe 2.07