SCOPe 2.05: Domain d3qh3a1: 3qh3 A:1-111

Lineage for d3qh3a1 (3qh3 A:1-111)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (18 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
Domain d3qh3a1: 3qh3 A:1-111 [215226]
Other proteins in same PDB: d3qh3a2, d3qh3b1, d3qh3b2, d3qh3c2, d3qh3d1, d3qh3d2
automated match to d1qrnd1
complexed with edo, gol

Details for d3qh3a1

PDB Entry: 3qh3 (more details), 2.19 Å

PDB Description: The crystal structure of TCR A6

PDB Compounds: (A:) A6 alpha chain

SCOPe Domain Sequences for d3qh3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qh3a1 b.1.1.1 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d3qh3a1:

Click to download the PDB-style file with coordinates for d3qh3a1.
(The format of our PDB-style files is described here.)

Timeline for d3qh3a1: