Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries) |
Domain d3qfua2: 3qfu A:235-426 [215221] automated match to d1qqma2 complexed with adp, mg, po4 |
PDB Entry: 3qfu (more details), 1.8 Å
SCOPe Domain Sequences for d3qfua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfua2 c.55.1.0 (A:235-426) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dkehqiivydlgggtfdvsllsiengvfevqatsgdthlggedfdykivrqlikafkkkh gidvsdnnkalaklkreaekakralssqmstrieidsfvdgidlsetltrakfeelnldl fkktlkpvekvlqdsglekkdvddivlvggstripkvqqllesyfdgkkaskginpdeav aygaavqagvls
Timeline for d3qfua2: