Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226188] (5 PDB entries) |
Domain d3qfta2: 3qft A:522-680 [215219] Other proteins in same PDB: d3qfta1 automated match to d1ja1a3 complexed with fad, nap; mutant |
PDB Entry: 3qft (more details), 1.4 Å
SCOPe Domain Sequences for d3qfta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfta2 c.25.1.0 (A:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard vqntfydivaelgamehaqavdyikklmtkgrysldvws
Timeline for d3qfta2: