Lineage for d3qfta1 (3qft A:246-521)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317445Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1317446Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 1317467Protein automated matches [227066] (1 species)
    not a true protein
  7. 1317468Species Human (Homo sapiens) [TaxId:9606] [226187] (2 PDB entries)
  8. 1317469Domain d3qfta1: 3qft A:246-521 [215218]
    Other proteins in same PDB: d3qfta2
    automated match to d1ja1a1
    complexed with fad, nap; mutant

Details for d3qfta1

PDB Entry: 3qft (more details), 1.4 Å

PDB Description: Crystal Structure of NADPH-Cytochrome P450 Reductase (FAD/NADPH domain and R457H Mutant)
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qfta1:

Sequence, based on SEQRES records: (download)

>d3qfta1 b.43.4.1 (A:246-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfp
cptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvve
arrhilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveyetka
grinkgvatnwlrakepvgenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d3qfta1 b.43.4.1 (A:246-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfp
cptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvve
arrhilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveyetka
grinkgvatnwlrakepvnggralvpmfvrksqf

SCOPe Domain Coordinates for d3qfta1:

Click to download the PDB-style file with coordinates for d3qfta1.
(The format of our PDB-style files is described here.)

Timeline for d3qfta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qfta2