SCOPe 2.03: Domain d3qfsa2: 3qfs A:522-680

Lineage for d3qfsa2 (3qfs A:522-680)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226188] (2 PDB entries)

8. Domain d3qfsa2: 3qfs A:522-680 [215217]
   Other proteins in same PDB: d3qfsa1
   automated match to d1ja1a3
   complexed with fad, nap

Details for d3qfsa2

PDB Entry: 3qfs, 1.4 Å

PDB Description: Crystal Structure of NADPH-Cytochrome P450 Reductase (FAD/NADPH domain)

PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qfsa2:

Sequence; same for both SEQRES and ATOM records:

>d3qfsa2 c.25.1.0 (A:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

Timeline for d3qfsa2:

• d3qfsa2 is new in SCOPe 2.03-stable
  
• d3qfsa2 appears in SCOPe 2.04
  
• d3qfsa2 appears in the current release, SCOPe 2.08