SCOPe 2.03: Domain d3qeud1: 3qeu D:0-110

Lineage for d3qeud1 (3qeu D:0-110)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)
Domain d3qeud1: 3qeu D:0-110 [215206]
Other proteins in same PDB: d3qeua2, d3qeub1, d3qeub2, d3qeud2, d3qeue1, d3qeue2
automated match to d1qrnd1
complexed with gol, li

Details for d3qeud1

PDB Entry: 3qeu (more details), 2.09 Å

PDB Description: the crystal structure of tcr dmf5

PDB Compounds: (D:) DMF5 alpha chain

SCOPe Domain Sequences for d3qeud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qeud1 b.1.1.1 (D:0-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akeveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgr
ftaqlnkasqyvsllirdsqpsdsatylcavnfgggklifgqgtelsvkpn

SCOPe Domain Coordinates for d3qeud1:

Click to download the PDB-style file with coordinates for d3qeud1.
(The format of our PDB-style files is described here.)

Timeline for d3qeud1: