Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
Domain d3qehh2: 3qeh H:107-210 [215201] Other proteins in same PDB: d3qehb1, d3qehd1, d3qehf1, d3qehh1 automated match to d1rhha2 complexed with cl, gol, so4 |
PDB Entry: 3qeh (more details), 2.59 Å
SCOPe Domain Sequences for d3qehh2:
Sequence, based on SEQRES records: (download)
>d3qehh2 b.1.1.2 (H:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
>d3qehh2 b.1.1.2 (H:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppdeqlkssvvcllnnfpreqwkqsgnsqesvteqdskdstyslsstla dyekhyacevthqglpvtksfnr
Timeline for d3qehh2: