Lineage for d3qehf2 (3qeh F:107-210)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517665Domain d3qehf2: 3qeh F:107-210 [215199]
    Other proteins in same PDB: d3qehb1, d3qehd1, d3qehf1, d3qehh1
    automated match to d1rhha2
    complexed with cl, gol, so4

Details for d3qehf2

PDB Entry: 3qeh (more details), 2.59 Å

PDB Description: Crystal structure of human N12-i15, an ADCC and non-neutralizing anti-HIV-1 Env antibody
PDB Compounds: (F:) Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain

SCOPe Domain Sequences for d3qehf2:

Sequence, based on SEQRES records: (download)

>d3qehf2 b.1.1.2 (F:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records): (download)

>d3qehf2 b.1.1.2 (F:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwnalqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d3qehf2:

Click to download the PDB-style file with coordinates for d3qehf2.
(The format of our PDB-style files is described here.)

Timeline for d3qehf2: