Lineage for d3qehf1 (3qeh F:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033145Domain d3qehf1: 3qeh F:1-106 [215198]
    Other proteins in same PDB: d3qehb2, d3qehd2, d3qehf2, d3qehh2
    automated match to d1rhha1
    complexed with cl, gol, so4

Details for d3qehf1

PDB Entry: 3qeh (more details), 2.59 Å

PDB Description: Crystal structure of human N12-i15, an ADCC and non-neutralizing anti-HIV-1 Env antibody
PDB Compounds: (F:) Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain

SCOPe Domain Sequences for d3qehf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qehf1 b.1.1.0 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveik

SCOPe Domain Coordinates for d3qehf1:

Click to download the PDB-style file with coordinates for d3qehf1.
(The format of our PDB-style files is described here.)

Timeline for d3qehf1: