SCOP 1.61: Domain d1adqa2: 1adq A:342-443

Lineage for d1adqa2 (1adq A:342-443)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fc (human) IgG1 class [49120] (9 PDB entries)

8. Domain d1adqa2: 1adq A:342-443 [21519]
   Other proteins in same PDB: d1adqh1, d1adql1

Details for d1adqa2

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqa2:

Sequence; same for both SEQRES and ATOM records:

>d1adqa2 b.1.1.2 (A:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsqeemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflysrltvdksrwqegnvfscsvmhealhnhytqkslsl

Timeline for d1adqa2:

• d1adqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1adqa2 appears in SCOP 1.59
  
• d1adqa2 appears in SCOP 1.63
  
• d1adqa2 appears in the current release, SCOPe 2.08