Lineage for d1adqa2 (1adq A:342-443)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9145Species Fc (human) IgG1 class [49120] (6 PDB entries)
  8. 9151Domain d1adqa2: 1adq A:342-443 [21519]
    Other proteins in same PDB: d1adqh1, d1adql1

Details for d1adqa2

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adqa2 b.1.1.2 (A:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsqeemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflysrltvdksrwqegnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1adqa2:

Click to download the PDB-style file with coordinates for d1adqa2.
(The format of our PDB-style files is described here.)

Timeline for d1adqa2: