Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (32 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [187778] (2 PDB entries) |
Domain d3qdlc_: 3qdl C: [215188] automated match to d3ge6a_ complexed with fmn, gol |
PDB Entry: 3qdl (more details), 2 Å
SCOPe Domain Sequences for d3qdlc_:
Sequence, based on SEQRES records: (download)
>d3qdlc_ d.90.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]} mkfldqekrrqllnerhsckmfdshyefssteleeiaeiarlspssyntqpwhfvmvtdk dlkkqiaahsyfneemiksasalmvvcslrpsellphghymqnlypesykvrvipsfaqm lgvrfnhsmqrlesyileqcyiavgqicmgvslmgldsciiggfdplkvgevleerinkp kiaclialgkrvaeasqksrkskvdaitwl
>d3qdlc_ d.90.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]} mkfldqekrrqllnerhsckmfdshyefssteleeiaeiarlspssyntqpwhfvmvtdk dlkkqiaahsyfneemiksasalmvvcslrpsellpmqrlesyileqcyiavgqicmgvs lmgldsciiggfdplkvgevleerinkpkiaclialgkrvaeasqksrkskvdaitwl
Timeline for d3qdlc_: