Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
Protein automated matches [191196] (8 species) not a true protein |
Species Coccidioides immitis [TaxId:246410] [226073] (3 PDB entries) |
Domain d3qd5b_: 3qd5 B: [215185] automated match to d2vvpa_ complexed with edo, iod |
PDB Entry: 3qd5 (more details), 1.9 Å
SCOPe Domain Sequences for d3qd5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qd5b_ c.121.1.0 (B:) automated matches {Coccidioides immitis [TaxId: 246410]} tplpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaql ikdgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvig ielakrlagewltyrfdqksasaqkvqaisdyekkfvevn
Timeline for d3qd5b_: