Lineage for d3qd5a_ (3qd5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169121Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2169122Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2169174Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2169175Protein automated matches [191196] (8 species)
    not a true protein
  7. 2169182Species Coccidioides immitis [TaxId:246410] [226073] (3 PDB entries)
  8. 2169184Domain d3qd5a_: 3qd5 A: [215184]
    automated match to d2vvpa_
    complexed with edo, iod

Details for d3qd5a_

PDB Entry: 3qd5 (more details), 1.9 Å

PDB Description: crystal structure of a putative ribose-5-phosphate isomerase from coccidioides immitis solved by combined iodide ion sad and mr
PDB Compounds: (A:) putative ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3qd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qd5a_ c.121.1.0 (A:) automated matches {Coccidioides immitis [TaxId: 246410]}
atplpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaq
likdgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvi
gielakrlagewltyrfdqksasaqkvqaisdyekkfvev

SCOPe Domain Coordinates for d3qd5a_:

Click to download the PDB-style file with coordinates for d3qd5a_.
(The format of our PDB-style files is described here.)

Timeline for d3qd5a_: