SCOP 1.69: Domain d1adqa1: 1adq A:238-341

Lineage for d1adqa1 (1adq A:238-341)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)

8. Domain d1adqa1: 1adq A:238-341 [21518]
   Other proteins in same PDB: d1adqa2, d1adqh1, d1adqh2, d1adql1, d1adql2
   part of a Fc

Details for d1adqa1

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqa1:

Sequence; same for both SEQRES and ATOM records:

>d1adqa1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvsqedpqvqfnwyvdgvqvhnaktkpreqqfn
styrvvsvltvlhqnwldgkeykckvsnkglpssiektiskakg

Timeline for d1adqa1:

• d1adqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1adqa1 appears in SCOP 1.67
  
• d1adqa1 appears in SCOP 1.71
  
• d1adqa1 appears in the current release, SCOPe 2.08