SCOPe 2.04: Domain d3qcvm1: 3qcv M:1-107

Lineage for d3qcvm1 (3qcv M:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d3qcvm1: 3qcv M:1-107 [215177]
   Other proteins in same PDB: d3qcvl2, d3qcvm2
   automated match to d1t66c1
   complexed with 18l

Details for d3qcvm1

PDB Entry: 3qcv, 2.51 Å

PDB Description: crystal structure of the lt3015 antibody fab fragment in complex with lysophosphatidic acid (18:2)

PDB Compounds: (M:) LT3015 antibody Fab fragment, light chain

SCOPe Domain Sequences for d3qcvm1:

Sequence; same for both SEQRES and ATOM records:

>d3qcvm1 b.1.1.1 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqtplslpvtpgepasisctsgqslvhingntylhwylqkpgqspklliykvsnlf
sgvpdrfsgsgsgtdftlkisrveaedvgvyfcsqsthfpftfgqgtkleik

Timeline for d3qcvm1:

• d3qcvm1 first appeared in SCOPe 2.03
  
• d3qcvm1 appears in SCOPe 2.05
  
• d3qcvm1 appears in the current release, SCOPe 2.08