Lineage for d1fc2d2 (1fc2 D:342-444)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9145Species Fc (human) IgG1 class [49120] (6 PDB entries)
  8. 9153Domain d1fc2d2: 1fc2 D:342-444 [21517]
    Other proteins in same PDB: d1fc2c_

Details for d1fc2d2

PDB Entry: 1fc2 (more details), 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution

SCOP Domain Sequences for d1fc2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc2d2 b.1.1.2 (D:342-444) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1fc2d2:

Click to download the PDB-style file with coordinates for d1fc2d2.
(The format of our PDB-style files is described here.)

Timeline for d1fc2d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc2d1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fc2c_