SCOP 1.67: Domain d1fc2d1: 1fc2 D:238-341

Lineage for d1fc2d1 (1fc2 D:238-341)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (20 PDB entries)

8. Domain d1fc2d1: 1fc2 D:238-341 [21516]
   Other proteins in same PDB: d1fc2c_, d1fc2d2
   part of a Fc
   complexed with fuc, gal, man, nag, so4

Details for d1fc2d1

PDB Entry: 1fc2, 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution

SCOP Domain Sequences for d1fc2d1:

Sequence; same for both SEQRES and ATOM records:

>d1fc2d1 b.1.1.2 (D:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1fc2d1:

• d1fc2d1 first appeared (with stable ids) in SCOP 1.55
  
• d1fc2d1 appears in SCOP 1.65
  
• d1fc2d1 appears in SCOP 1.69
  
• d1fc2d1 appears in the current release, SCOPe 2.08