Lineage for d1dn2b2 (1dn2 B:342-443)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516151Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 1516154Species Human (Homo sapiens) [TaxId:9606] [88590] (35 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1516177Domain d1dn2b2: 1dn2 B:342-443 [21515]
    Other proteins in same PDB: d1dn2a1, d1dn2b1
    part of a Fc

Details for d1dn2b2

PDB Entry: 1dn2 (more details), 2.7 Å

PDB Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2
PDB Compounds: (B:) immunoglobulin lambda heavy chain

SCOPe Domain Sequences for d1dn2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn2b2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d1dn2b2:

Click to download the PDB-style file with coordinates for d1dn2b2.
(The format of our PDB-style files is described here.)

Timeline for d1dn2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dn2b1