SCOPe 2.08: Domain d3q93b_: 3q93 B:

Lineage for d3q93b_ (3q93 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries)

8. Domain d3q93b_: 3q93 B: [215132]
   automated match to d3zr0b_
   complexed with gol, imd, so4

Details for d3q93b_

PDB Entry: 3q93, 1.8 Å

PDB Description: Crystal Structure of Human 8-oxo-dGTPase (MTH1)

PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d3q93b_:

Sequence; same for both SEQRES and ATOM records:

>d3q93b_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d3q93b_:

• d3q93b_ first appeared in SCOPe 2.03
  
• d3q93b_ appears in SCOPe 2.07