Lineage for d1dn2a2 (1dn2 A:342-443)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221728Species Fc (human) IgG1 class [49120] (14 PDB entries)
  8. 221732Domain d1dn2a2: 1dn2 A:342-443 [21513]

Details for d1dn2a2

PDB Entry: 1dn2 (more details), 2.7 Å

PDB Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2

SCOP Domain Sequences for d1dn2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn2a2 b.1.1.2 (A:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1dn2a2:

Click to download the PDB-style file with coordinates for d1dn2a2.
(The format of our PDB-style files is described here.)

Timeline for d1dn2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dn2a1