SCOPe 2.05: Domain d1dn2a1: 1dn2 A:237-341

Lineage for d1dn2a1 (1dn2 A:237-341)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (41 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1dn2a1: 1dn2 A:237-341 [21512]
   Other proteins in same PDB: d1dn2a2, d1dn2b2
   part of a Fc

Details for d1dn2a1

PDB Entry: 1dn2, 2.7 Å

PDB Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2

PDB Compounds: (A:) immunoglobulin lambda heavy chain

SCOPe Domain Sequences for d1dn2a1:

Sequence; same for both SEQRES and ATOM records:

>d1dn2a1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshenpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d1dn2a1:

• d1dn2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1dn2a1 appears in SCOPe 2.04
  
• d1dn2a1 appears in SCOPe 2.06
  
• d1dn2a1 appears in the current release, SCOPe 2.08