Lineage for d1dn2a1 (1dn2 A:237-341)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108193Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1108194Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1108206Domain d1dn2a1: 1dn2 A:237-341 [21512]
    Other proteins in same PDB: d1dn2a2, d1dn2b2
    part of a Fc

Details for d1dn2a1

PDB Entry: 1dn2 (more details), 2.7 Å

PDB Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2
PDB Compounds: (A:) immunoglobulin lambda heavy chain

SCOPe Domain Sequences for d1dn2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn2a1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshenpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1dn2a1:

Click to download the PDB-style file with coordinates for d1dn2a1.
(The format of our PDB-style files is described here.)

Timeline for d1dn2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dn2a2