Lineage for d1b6db2 (1b6d B:108-212)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53386Species Bence-Jones kappa L chain DEL (human) [49119] (1 PDB entry)
  8. 53388Domain d1b6db2: 1b6d B:108-212 [21511]
    Other proteins in same PDB: d1b6da1, d1b6db1

Details for d1b6db2

PDB Entry: 1b6d (more details), 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

SCOP Domain Sequences for d1b6db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6db2 b.1.1.2 (B:108-212) Immunoglobulin (constant domains of L and H chains) {Bence-Jones kappa L chain DEL (human)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1b6db2:

Click to download the PDB-style file with coordinates for d1b6db2.
(The format of our PDB-style files is described here.)

Timeline for d1b6db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6db1