Lineage for d3q74b2 (3q74 B:81-209)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735638Protein Class alpha GST [81349] (8 species)
  7. 1735651Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
    Uniprot P08263
  8. 1735665Domain d3q74b2: 3q74 B:81-209 [215095]
    Other proteins in same PDB: d3q74a1, d3q74b1
    automated match to d1agsa1
    mutant

Details for d3q74b2

PDB Entry: 3q74 (more details), 1.79 Å

PDB Description: Crystal Structure Analysis of the L7A Mutant of the Apo Form of Human Alpha Class Glutathione Transferase
PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3q74b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q74b2 a.45.1.1 (B:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOPe Domain Coordinates for d3q74b2:

Click to download the PDB-style file with coordinates for d3q74b2.
(The format of our PDB-style files is described here.)

Timeline for d3q74b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q74b1